PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g080090.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 630aa    MW: 69846.5 Da    PI: 4.6354
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g080090.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.36.2e-53271551128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp+G+rF+Ptdeelv++yL+ k++g + ++ +vi+evdi+k+ePwdLp  + v+++++ew+fF+++d+ky++g+r nrat++gyWkatgkd
  Solyc03g080090.2.1  27 LPVGYRFRPTDEELVNHYLRLKINGADSQV-SVIREVDICKLEPWDLPdlSVVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKD 116
                         799************************999.99**************96448888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++++kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  Solyc03g080090.2.1 117 RNIVTKKGSKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 155
                         *************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5422165IPR003441NAC domain
PROSITE profilePS5100550.61827183IPR003441NAC domain
PfamPF023651.4E-2628154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MAVLPGENPI AVLPVDKQMG IPPLNTLPVG YRFRPTDEEL VNHYLRLKIN GADSQVSVIR  60
EVDICKLEPW DLPDLSVVES HDNEWFFFCP KDRKYQNGQR LNRATERGYW KATGKDRNIV  120
TKKGSKIGMK KTLVYYIGRA PEGKRTHWVI HEYRATEKSL DGSHPGQNDL KQDEHVDNSN  180
LDAEQNASVD KSPAEDELSE AATPLTVIPP LNDCDKSYAA KFSKGEMYGK QLPIESHSNS  240
CIADDTEDQM LDITSIPDLE KELGNFYDPS SQPDWKIFSP LHSQMQAELG SSYLQAPLNN  300
DMFGYQKDVQ FPYGTNALDI NDFLNSVLVN SDEFSCEDSG QELASHHIDT KNCSITGPMI  360
KDSGSCSESE AEVTQGLVEP DFFDPEVLWD NFDREAAVKR EVNSLEATAL KARSPLGLSY  420
VGNDYAVGNL GFFQNTYPGH YGYPASIGGS QVPNFLKVEQ SGVRNNVAST ESGSGTGIKL  480
RTRQMHNQLD DTQFNQPDNT QSRQQGTAHR RIRLHMKMQV GPVECRMRSD SSEGAEIHEA  540
VAEGEKASDE HSSTTSDTTT IKDLVGETDE LSTQVKDADD SPVEESLDVS FKSATKLSSS  600
SHVYMSKVLV VASLLVVFIG VWSCFRLCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-412715415139Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.49630.0callus| flower| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0130040.0Lycopersicon esculentum clone 114229R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010318064.10.0PREDICTED: uncharacterized protein LOC101253566
TrEMBLK4BHY50.0K4BHY5_SOLLC; Uncharacterized protein
STRINGSolyc03g080090.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Representative plantOGRP9409612
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.24e-82TCV-interacting protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]